PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2983s0148.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GATA
Protein Properties Length: 619aa    MW: 69035.5 Da    PI: 5.966
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2983s0148.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR30.19.9e-10377419240
                  TCR   2 ekkgCnCkkskCl....kkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+C+C+k + l    k YC+Cfaag +C e C+C++C+Nk 
  Bostr.2983s0148.1.p 377 SCKRCKCSKIQMLeampKTYCDCFAAGLYCLEPCSCQNCFNKP 419
                          689******9987666699**********************96 PP

2TCR25.62.6e-08466497139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          ++++gC C+ks Cl+kYCeCf        +C+C +CkN 
  Bostr.2983s0148.1.p 466 RHSRGCDCRKSGCLQKYCECFM-------RCRCMGCKNI 497
                          5899*****************7.......5*******96 PP

3GATA53.72.8e-17555587133
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                          Cs+Cg+ +T +WR gp+g ktLCnaCG++y++ 
  Bostr.2983s0148.1.p 555 CSHCGVQETLQWRAGPSGAKTLCNACGVRYKSD 587
                          *******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF542367.6E-11172IPR029071Ubiquitin-related domain
Gene3DG3DSA:3.10.20.901.3E-9153No hitNo description
SMARTSM002133.8E-7172IPR000626Ubiquitin domain
PROSITE profilePS5005313.467153IPR000626Ubiquitin domain
PfamPF002405.7E-10453IPR000626Ubiquitin domain
SMARTSM011142.7E-6376421IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163426.466377499IPR005172CRC domain
PfamPF036389.5E-6379418IPR005172CRC domain
SMARTSM011143.8E-6466500IPR033467Tesmin/TSO1-like CXC domain
SuperFamilySSF577167.13E-12547586No hitNo description
SMARTSM004014.9E-13549601IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.082549585IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.1E-13553587IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.50E-11554586No hitNo description
PROSITE patternPS003440555580IPR000679Zinc finger, GATA-type
PfamPF003204.2E-15555587IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MKVVVDTESG SLFSIDVGFL DTELTIKQKI EQSQGIPVFK QNLFFQGKVL RDHIDYFVRQ  60
CLPKSRLLLF VSHWPVMSNN DQVLETEESP MALMKELFGI QDSPEGKNNQ VLHQTEQSPL  120
PSNSSGETIH GGDRALTAEQ VCKNQHDRPV TIHKITHGQD SSVQLALKNS QRNEKTLTGG  180
AKNGDDFSVD DLLDFSNEDD DVFVEDETEL KVQRKGGVSD ENTLHRSNDF STGDFPTSEL  240
SVPMDDLAEL EWLSNFVEGS FKPYSAAPTK KPVWLTGNQR HPVPPVNEDS CFKAPANLVE  300
PGGSCSVQVA PGPPGPTTFH HNIEDEFSTP VTTKRDLVYS DIKIKKAPER SIEGECFDQH  360
MVTENRELSQ GLDELDSCKR CKCSKIQMLE AMPKTYCDCF AAGLYCLEPC SCQNCFNKPI  420
HDDLVMKTRQ VIEARNPLAF APKVASTSDS AIDLWDENSK TPASARHSRG CDCRKSGCLQ  480
KYCECFMRCR CMGCKNIFGH ASSSATSSSS SYGPSSPLRL ADSEFLDEPM AKRQKQEKVC  540
RNNSQTQTQT QTQRCSHCGV QETLQWRAGP SGAKTLCNAC GVRYKSDRPF KRFQLSLLQE  600
GHFFINKQNV MDDDRSSR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.13e-96Tesmin/TSO1-like CXC domain-containing protein